PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G003600.1.p
Common NameSb03g000490, SORBIDRAFT_03g000490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Nin-like
Protein Properties Length: 934aa    MW: 102372 Da    PI: 6.0069
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G003600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29588639152
                RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Sobic.003G003600.1.p 588 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 639
                           589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.655578659IPR003035RWP-RK domain
PfamPF020423.3E-26591639IPR003035RWP-RK domain
SuperFamilySSF542772.22E-20829924No hitNo description
SMARTSM006661.9E-24839921IPR000270PB1 domain
PfamPF005641.2E-14839920IPR000270PB1 domain
PROSITE profilePS5174517.825839921IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.7E-24839920No hitNo description
CDDcd064071.86E-33840920No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 934 aa     Download sequence    Send to blast
MDLDPSPASA HGDGGGCADA WPFDSLTTSM LFSSVSASPQ LQPLPANSSW LTPPSPLWLF  60
EDRHMLPLDA PDAAPEAAVA AAVVEEVQRA RSGNSDTSSK RVEQINHKWQ FHLSLDEDGT  120
DNSSLFKEKL TQALRYFKES TDQHLLVQVW APVKNGDRYV LTTSGQPFVL DHQSIGLLQY  180
RAVSMMYMFS VDGENVGELG LPGRVYKQKV PEWTPNVQYY SSGEYQRLNH AISYNVHGTV  240
ALPVFDPAAQ SCIAVVELIM TSKKINYACE VDKVCKALEA VNLKSTEILD HPNVQICNEG  300
RQAALVEILE ILTVVCEEHK LPLAQTWVPC KYRSVLAHGG GLKKSCLSFD GSCMGEVCMS  360
TSDVAFHVID AHMWGFRDAC VEHHLQRGQG VSGKAFISHK PCFSKDIQKF CKLTYPLVHY  420
ARMFGLAGCF AICLQSSYTG NDDYVLEFFL PPDCIDEDDQ NALLESILTL MKRCLRSLKV  480
VGDRYSSGAS LQLSNVLKLE NEEFKTDAQF DNSDGSLHES PGGDRHGGAH KFDNGNKKVL  540
DLTEGQLLTD DYSQDNGTSA GRPNGSGASD SSLLHKTNKP PERRRGKAEK TISLEVLQQY  600
FSGSLKNAAK SLGVCPTTMK RICRQHGISR WPSRKINKVN RSLSKLKQVI ESVQGSDAAF  660
NLTSITGPLP IPVGPSSESL NVERLTQSKV AELSNLAVDG DRDSLQKSLE NDDHFGIVMA  720
HQGFIDNNND SQLEADKASH SRSSSGEGSI NSRTSEGSCQ GSPANQTFVC KPIASTFAEP  780
QLNQEFNKEP FQEPQLPLSR MLIEDSGSSK DLKNLFTSTS DQPFLAPPNN LVSVKHSGTV  840
TIKASFKEDI VRFRFPCSGG VIVLKEEVAK RLRMDVGTFD IKYLDDDHEW VKLACNADLE  900
ECMEISRLSG SHVIRLLVSD IAAHFGSSCG SSG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.96470.0leaf| panicle| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0853590.0BT085359.2 Zea mays full-length cDNA clone ZM_BFc0002J20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457049.10.0hypothetical protein SORBIDRAFT_03g000490
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLC5XJJ30.0C5XJJ3_SORBI; Putative uncharacterized protein Sb03g000490
STRINGSb03g000490.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein